Sequence 1: | NP_651514.1 | Gene: | Spag1 / 43239 | FlyBaseID: | FBgn0039463 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099139.2 | Gene: | TTC24 / 164118 | HGNCID: | 32348 | Length: | 582 | Species: | Homo sapiens |
Alignment Length: | 312 | Identity: | 55/312 - (17%) |
---|---|---|---|
Similarity: | 88/312 - (28%) | Gaps: | 132/312 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 130 ESKTEKPKPAPKATSPSNTKNKEARIKSTDYRKWDKYDPDEEILRMDLNEERDQEQREKIISNHS 194
Fly 195 KS-VTTDKLQSERDSLYERLQAQLKNLSQL--------------------EKEQFAERHRLRGNE 238
Fly 239 SFKA--------------KEYENAIEEYN--------------C-SIIYDPENAVHAYNNRAVAH 274
Fly 275 L---KLKKYFSAISDCQAC---------------------------------------------L 291
Fly 292 QIDPMNIKAHLR-----------------MAEAHNAEGKHLESLNVYKKLLD 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Spag1 | NP_651514.1 | TPR_11 | 229..295 | CDD:290150 | 18/142 (13%) |
TPR repeat | 229..257 | CDD:276809 | 8/56 (14%) | ||
TPR repeat | 262..293 | CDD:276809 | 7/78 (9%) | ||
TPR_11 | 266..329 | CDD:290150 | 17/126 (13%) | ||
TPR | 266..297 | CDD:197478 | 7/78 (9%) | ||
TPR repeat | 298..326 | CDD:276809 | 9/44 (20%) | ||
TTC24 | NP_001099139.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | 12/34 (35%) | |
TPR_12 | 36..105 | CDD:290160 | 11/70 (16%) | ||
TPR 1 | 36..69 | 3/32 (9%) | |||
TPR repeat | 36..64 | CDD:276809 | 3/27 (11%) | ||
TPR 2 | 79..112 | 6/32 (19%) | |||
TPR_12 | 80..148 | CDD:290160 | 12/71 (17%) | ||
TPR repeat | 81..111 | CDD:276809 | 3/29 (10%) | ||
TPR repeat | 116..146 | CDD:276809 | 5/32 (16%) | ||
TPR 3 | 117..150 | 5/32 (16%) | |||
TPR_11 | 121..180 | CDD:290150 | 9/58 (16%) | ||
TPR 4 | 154..187 | 6/32 (19%) | |||
TPR repeat | 154..180 | CDD:276809 | 5/25 (20%) | ||
TPR_12 | 232..302 | CDD:290160 | 13/70 (19%) | ||
TPR 5 | 236..271 | 5/34 (15%) | |||
TPR repeat | 238..264 | CDD:276809 | 5/25 (20%) | ||
TPR_12 | 271..345 | CDD:290160 | 8/31 (26%) | ||
TPR 6 | 273..306 | 8/29 (28%) | |||
TPR | 273..302 | CDD:197478 | 8/29 (28%) | ||
TPR repeat | 273..301 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 312..342 | CDD:276809 | |||
TPR 7 | 313..346 | ||||
TPR_12 | 314..385 | CDD:290160 | |||
TPR 8 | 353..386 | ||||
TPR repeat | 353..381 | CDD:276809 | |||
TPR_1 | 353..>380 | CDD:278916 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 418..481 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 548..582 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |