DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and TTC24

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001099139.2 Gene:TTC24 / 164118 HGNCID:32348 Length:582 Species:Homo sapiens


Alignment Length:312 Identity:55/312 - (17%)
Similarity:88/312 - (28%) Gaps:132/312 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 ESKTEKPKPAPKATSPSNTKNKEARIKSTDYRKWDKYDPDEEILRMDLNEERDQEQREKIISNHS 194
            |....:|:|.|   |.||.|.|:        |||.:.:...:.|....:......|..:.::|..
Human     7 EDVPRRPEPEP---SSSNKKKKK--------RKWLRQEASIQALTRAGHGALQAGQNHEALNNFQ 60

  Fly   195 KS-VTTDKLQSERDSLYERLQAQLKNLSQL--------------------EKEQFAERHRLRGNE 238
            :: :...|....||:  ..|||...||...                    ||.| ..||   |::
Human    61 RAFLLASKAPQTRDT--PVLQACAFNLGAAYVETGDPARGLELLLRAHPEEKAQ-GRRH---GDQ 119

  Fly   239 SFKA--------------KEYENAIEEYN--------------C-SIIYDPENAVHAYNNRAVAH 274
            .|..              ..|..|:..|.              | ..:..||.|.|.....:.|:
Human   120 CFNVALAYHALGELPQALAWYHRALGHYQPQGDQGEAWAKMGACYQALGQPELAAHCLQEASQAY 184

  Fly   275 L---KLKKYFSAISDCQAC---------------------------------------------L 291
            .   :|:....|:.....|                                             |
Human   185 AQERQLRAAALALGAAAGCMLKSGRHRVGEVVQVLEKSRRLAERSTERRLLGHLYNDLGLGYSQL 249

  Fly   292 QIDPMNIKAHLR-----------------MAEAHNAEGKHLESLNVYKKLLD 326
            |:.|:.::|.|:                 :..||||.|.:.|:...::|..|
Human   250 QLFPLAVEAFLQALPLCWVPGEQATVLRNLGMAHNALGNYQEAREFHQKAAD 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 18/142 (13%)
TPR repeat 229..257 CDD:276809 8/56 (14%)
TPR repeat 262..293 CDD:276809 7/78 (9%)
TPR_11 266..329 CDD:290150 17/126 (13%)
TPR 266..297 CDD:197478 7/78 (9%)
TPR repeat 298..326 CDD:276809 9/44 (20%)
TTC24NP_001099139.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 12/34 (35%)
TPR_12 36..105 CDD:290160 11/70 (16%)
TPR 1 36..69 3/32 (9%)
TPR repeat 36..64 CDD:276809 3/27 (11%)
TPR 2 79..112 6/32 (19%)
TPR_12 80..148 CDD:290160 12/71 (17%)
TPR repeat 81..111 CDD:276809 3/29 (10%)
TPR repeat 116..146 CDD:276809 5/32 (16%)
TPR 3 117..150 5/32 (16%)
TPR_11 121..180 CDD:290150 9/58 (16%)
TPR 4 154..187 6/32 (19%)
TPR repeat 154..180 CDD:276809 5/25 (20%)
TPR_12 232..302 CDD:290160 13/70 (19%)
TPR 5 236..271 5/34 (15%)
TPR repeat 238..264 CDD:276809 5/25 (20%)
TPR_12 271..345 CDD:290160 8/31 (26%)
TPR 6 273..306 8/29 (28%)
TPR 273..302 CDD:197478 8/29 (28%)
TPR repeat 273..301 CDD:276809 7/27 (26%)
TPR repeat 312..342 CDD:276809
TPR 7 313..346
TPR_12 314..385 CDD:290160
TPR 8 353..386
TPR repeat 353..381 CDD:276809
TPR_1 353..>380 CDD:278916
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..481
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 548..582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.