DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and TMTC3

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_861448.2 Gene:TMTC3 / 160418 HGNCID:26899 Length:914 Species:Homo sapiens


Alignment Length:442 Identity:92/442 - (20%)
Similarity:172/442 - (38%) Gaps:107/442 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PIH---YLDFAHVEKCTNAREMEKIVQILRSGEEGHYPDLQRCAEEKLKALKPDSKLFRYEEQIK 77
            |.|   |::.|::.:...:| :|:..|:.|...... ||.::....:.:.|...:|..:.:|...
Human   525 PNHLNVYINLANLIRANESR-LEEADQLYRQAISMR-PDFKQAYISRGELLLKMNKPLKAKEAYL 587

  Fly    78 QSTDLDKTELKPILDWTDA----IKTKDNALNE-LKKVKQNLNLPSVRKLSKID---LEKESKTE 134
            ::.:||:.....   |.:.    |:.|:.  || ||...:.|.|....||:..:   :.:||...
Human   588 KALELDRNNADL---WYNLAIVHIELKEP--NEALKNFNRALELNPKHKLALFNSAIVMQESGEV 647

  Fly   135 KPKPAPKATSPSNTKNKEARIKSTDYRKWDKYDPDE----EILRMDLNEERDQEQR---EKIISN 192
            |.:|             |||.:...|...:..|.:.    .:|.||  :::|.|..   :|.|  
Human   648 KLRP-------------EARKRLLSYINEEPLDANGYFNLGMLAMD--DKKDNEAEIWMKKAI-- 695

  Fly   193 HSKSVTTDKLQSERDS-------LYERLQAQLKNLSQLEK--EQFAERHR---LRGNESFKAKE- 244
                    |||::..|       ||.:...:||.|..||:  ..:.:..:   |:|:.....|: 
Human   696 --------KLQADFRSALFNLALLYSQTAKELKALPILEELLRYYPDHIKGLILKGDILMNQKKD 752

  Fly   245 -------YENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKAHL 302
                   :|..:|       .||.| |...:|..|.:.:.|....|    :.|| ::.:.:..|.
Human   753 ILGAKKCFERILE-------MDPSN-VQGKHNLCVVYFEEKDLLKA----ERCL-LETLALAPHE 804

  Fly   303 RMAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVE------KLTSMLGEVAPSSATRLIIEEI 361
            ...:.|         ||:.:       |...:...:|      |::|:.|:..|:.:.:.|..|.
Human   805 EYIQRH---------LNIVR-------DKISSSSFIEPIFPTSKISSVEGKKIPTESVKEIRGES 853

  Fly   362 DPPQL-KTSEPKKEAEKSEPTVVKKPEPVVSAKKPPPIKDYDLAELVKPNRM 412
            ...|: |||:.|.:: ||...:.|..:.....|....||:.:...:....|:
Human   854 RQTQIVKTSDNKSQS-KSNKQLGKNGDEETPHKTTKDIKEIEKKRVAALKRL 904

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 15/76 (20%)
TPR repeat 229..257 CDD:276809 5/38 (13%)
TPR repeat 262..293 CDD:276809 8/30 (27%)
TPR_11 266..329 CDD:290150 10/62 (16%)
TPR 266..297 CDD:197478 6/30 (20%)
TPR repeat 298..326 CDD:276809 4/27 (15%)
TMTC3NP_861448.2 DUF1736 259..331 CDD:312047
TPR 1 412..445
TPR_11 <435..802 CDD:330823 68/321 (21%)
TPR 2 446..479
TPR repeat 446..474 CDD:276809
TPR repeat 479..523 CDD:276809
TPR 3 481..513
TPR 4 528..562 7/35 (20%)
TPR repeat 530..557 CDD:276809 6/27 (22%)
TPR repeat 562..592 CDD:276809 3/29 (10%)
TPR 5 563..596 5/32 (16%)
TPR repeat 597..625 CDD:276809 7/32 (22%)
TPR 7 668..701 10/44 (23%)
TPR repeat 668..696 CDD:276809 7/39 (18%)
TPR repeat 701..731 CDD:276809 8/29 (28%)
TPR 8 703..735 8/31 (26%)
TPR 9 736..770 7/40 (18%)
TPR repeat 736..765 CDD:276809 4/28 (14%)
TPR repeat 771..799 CDD:276809 7/32 (22%)
TPR 10 772..804 6/36 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 847..891 11/44 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.