DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Ifit2

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001342191.1 Gene:Ifit2 / 15958 MGIID:99449 Length:470 Species:Mus musculus


Alignment Length:440 Identity:99/440 - (22%)
Similarity:158/440 - (35%) Gaps:147/440 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EKKKSLLERYNIPIHY----LD----FAHVEKCT-NAREMEKIVQILRSGEEGHYPDLQRCAEEK 59
            :|.|.:.::::.|...    ||    :|.: ||| |..|..|:                 |.:  
Mouse   118 DKVKQVCKKFSSPYRIENPALDCEEGWARL-KCTKNQNERVKV-----------------CFQ-- 162

  Fly    60 LKALKPDSK-----------LFRYEEQIKQSTDLDKTELKPILDWTDAIKTKDNALNELKKVKQN 113
             |||:.|.|           .:|.::...::..:|..|        .||:...:  |...||...
Mouse   163 -KALEKDPKNPEFTSGWAIANYRLDDWPARNYCIDSLE--------QAIQLSPD--NTYVKVLLA 216

  Fly   114 LNLPSVRKLSKIDLEKESKTEKPKPAPKATSPSNTKNKEARIKSTDYRKWDKYDPDE--EILRMD 176
            |.|.:|.|...:.|.:|:..:.|       |..:|..:.||.    |.|  .||.|.  ::||..
Mouse   217 LKLDAVHKNQAMALVEEALKKDP-------SAIDTLLRAARF----YCK--VYDTDRAIQLLRKA 268

  Fly   177 LNEERDQEQREKIISN-----------HSKSVTTDKLQSERDSLYERLQAQLKNLSQLEKEQFAE 230
            |         ||:.:|           .||   ...:.:.|:.::...:.:|:.|.||     |.
Mouse   269 L---------EKLPNNAYVHYYMGCCYRSK---VHHMLNRREMVFSGDRKKLEELIQL-----AV 316

  Fly   231 RHRLRGNESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQID- 294
            .| ||     ||:|.:..: ||:||.:.|             .::..|||..|....|..|..| 
Mouse   317 NH-LR-----KAEEIKEML-EYSCSFLAD-------------LYIIAKKYDEADYYFQKELSKDL 361

  Fly   295 ---PMNIKAHLR--------MAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEKLTSMLGEV 348
               |..: .|||        |.....|...::|.:.:.||.:.       .||..|||..:    
Mouse   362 PPGPKQL-LHLRYGNFQFFQMKRQDKAIYHYMEGVKIKKKTIP-------QKKMREKLQRI---- 414

  Fly   349 APSSATRLIIEEIDPPQ------LKTSEPKKEAEKSEPTVVKKPEPVVSA 392
               :..||..:|.|...      |:.:...::|:|.....|.....|.||
Mouse   415 ---ALRRLHEDESDSEALHILAFLQENGGGQQADKDSERGVDSANQVPSA 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 19/69 (28%)
TPR repeat 229..257 CDD:276809 11/27 (41%)
TPR repeat 262..293 CDD:276809 6/30 (20%)
TPR_11 266..329 CDD:290150 16/74 (22%)
TPR 266..297 CDD:197478 8/34 (24%)
TPR repeat 298..326 CDD:276809 8/35 (23%)
Ifit2NP_001342191.1 TPR 1 51..89
TPR 2 90..135 3/16 (19%)
TPR repeat 96..122 CDD:276809 1/3 (33%)
TPR repeat 127..167 CDD:276809 14/60 (23%)
TPR 3 136..171 14/55 (25%)
PEP_TPR_lipo <145..359 CDD:274350 68/294 (23%)
TPR 4 172..208 5/45 (11%)
TPR 5 242..275 13/47 (28%)
TPR repeat 242..270 CDD:276809 11/42 (26%)
TPR repeat 275..325 CDD:276809 14/63 (22%)
TPR 6 276..331 14/69 (20%)
TPR repeat 330..358 CDD:276809 10/40 (25%)
TPR 7 332..362 10/42 (24%)
TPR 8 363..401 8/38 (21%)
TPR 9 402..443 10/54 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..470 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.