DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Ifit1

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_032357.2 Gene:Ifit1 / 15957 MGIID:99450 Length:463 Species:Mus musculus


Alignment Length:470 Identity:88/470 - (18%)
Similarity:159/470 - (33%) Gaps:186/470 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KSLLERYNIP---------IHYLDFAHVEKCTNAREMEKIVQILRSGEEGHYPDLQRCAEEKLKA 62
            |.|.|..:||         :.:||.      .|...|..::..:|     |....|   :|.|::
Mouse    24 KLLFENNDIPDLEVRISEQVQFLDI------KNPLGMHNLLAYVR-----HLKGQQ---DEALQS 74

  Fly    63 LKPDSKLFRYEEQIKQSTDLDKTELKPILDWTD---------AIKTKDNALNELKKVKQNLNLPS 118
            ||....|.:.|:..|:|          :..|.:         ::......|::::||.:..:.|.
Mouse    75 LKEAEALIQSEQLSKRS----------LATWGNCAWLHYHRGSLAEAQIYLDKVEKVCKEFSSPF 129

  Fly   119 VRKLSKIDLEKE--------------------SKTEKPKPAPKATSPSNTKNKEARIKSTDY--- 160
            ..:|...:::.|                    :|..|.:|          :|.|   .:|.|   
Mouse   130 RYRLECAEMDCEEGWALLKCGGGNYKQAMACFAKALKVEP----------ENPE---YNTGYAVV 181

  Fly   161 ----------------RKWDKYDPDEEILRM-------DLNEERDQEQR-EKIISNHS------- 194
                            ||..:.:|::..|::       ||.|..:.|.. |:.:|:.|       
Mouse   182 AYRQDLDDNFISLEPLRKAVRLNPEDPYLKVLLALKLQDLGEHVEAEAHIEEALSSTSCQSYVIR 246

  Fly   195 -------KSVTTDK--------LQSERDSLYERLQAQLKNLSQLEKEQFAERHRLRGNESFKAKE 244
                   :....||        ||:...|.|...|..|     ..|:|.::   ||.:.:.:.:.
Mouse   247 YAAKYFRRKHRVDKALHLLNRALQASPSSGYLHYQKGL-----CYKQQISQ---LRTSRNRQPRR 303

  Fly   245 YENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQID-------------PM 296
            .:| ::|.       .:.|:|.:...    |||:..|.....|.|.:|.:             .:
Mouse   304 QDN-VQEL-------AQQAIHEFQET----LKLRPTFEMAYVCMAEVQAEIHQYEEAERNFQKAL 356

  Fly   297 NIK---AHLRMAEAHNAEGKHLE--------SLNVYKKLLDFEPDNAIAKK---AVEKL------ 341
            |.|   ||:.. :.|...|:.|:        ::.:|.|.|..|..:...:|   |:||:      
Mouse   357 NNKTLVAHIEQ-DIHLRYGRFLQFHKQSEDKAITLYLKGLKVEEKSFAWRKLLTALEKVAERRVC 420

  Fly   342 --------TSMLGEV 348
                    ||:||.|
Mouse   421 QNVHLVESTSLLGLV 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 13/78 (17%)
TPR repeat 229..257 CDD:276809 4/27 (15%)
TPR repeat 262..293 CDD:276809 8/30 (27%)
TPR_11 266..329 CDD:290150 17/86 (20%)
TPR 266..297 CDD:197478 7/43 (16%)
TPR repeat 298..326 CDD:276809 8/38 (21%)
Ifit1NP_032357.2 TPR 1 52..85 9/40 (23%)
TPR_12 54..124 CDD:290160 16/87 (18%)
TPR repeat 55..86 CDD:276809 8/38 (21%)
TPR repeat 91..121 CDD:276809 3/39 (8%)
TPR 2 92..126 4/33 (12%)
TPR 3 136..171 4/44 (9%)
TPR repeat 136..166 CDD:276809 2/29 (7%)
TPR_16 145..208 CDD:290168 10/75 (13%)
TPR repeat 171..203 CDD:276809 6/34 (18%)
TPR 4 174..207 5/32 (16%)
type_IV_pilW <194..354 CDD:131573 34/179 (19%)
TPR repeat 208..236 CDD:276809 6/27 (22%)
TPR 5 209..241 8/31 (26%)
TPR 6 242..275 4/32 (13%)
TPR repeat 242..270 CDD:276809 2/27 (7%)
Interaction with the 5'-triphosphate group of PPP-RNA. /evidence=ECO:0000250 247..253 0/5 (0%)
TPR repeat 275..324 CDD:276809 13/68 (19%)
TPR 7 294..328 8/45 (18%)
TPR 8 329..362 5/32 (16%)
TPR repeat 329..356 CDD:276809 3/26 (12%)
TPR 9 367..401 7/34 (21%)
TPR 10 426..459 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.