DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Spag1 and TTC32

DIOPT Version :9

Sequence 1:	NP_651514.1	Gene:	Spag1 / 43239	FlyBaseID:	FBgn0039463	Length:	469	Species:	Drosophila melanogaster
Sequence 2:	NP_001008238.1	Gene:	TTC32 / 130502	HGNCID:	32954	Length:	151	Species:	Homo sapiens

Alignment Length:	140	Identity:	30/140 - (21%)
Similarity:	52/140 - (37%)	Gaps:	29/140 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   202 LQSERDSLYERL---QAQLKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCSIIYD---- 259
            ::.:|...:..|   ||...|      .::||...|          |...|....|:...|
Human     1 MEGQRQESHATLTLAQAHFNN------GEYAEAEAL----------YSAYIRRCACAASSDESPG 49

  Fly   260 ----PENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDP-MNIKAHLRMAEAHNAEGKHLESLN 319
                ||:...|||||.........::.|:.|..:.:::.| ..:..:.|....:.. |...::|.
Human    50 SKCSPEDLATAYNNRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRL-GYFDDALE 113

  Fly   320 VYKKLLDFEP 329
            .:||:||..|
Human   114 DFKKVLDLNP 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Spag1	NP_651514.1	TPR_11	229..295	CDD:290150	16/73 (22%)
		TPR repeat	229..257	CDD:276809	6/27 (22%)
		TPR repeat	262..293	CDD:276809	7/30 (23%)
		TPR_11	266..329	CDD:290150	15/63 (24%)
		TPR	266..297	CDD:197478	8/31 (26%)
		TPR repeat	298..326	CDD:276809	5/27 (19%)
TTC32	NP_001008238.1	TPR_11	2..>143	CDD:330823	30/139 (22%)
		TPR 1	8..41		9/48 (19%)
		PLN03088	<55..>123	CDD:330826	16/68 (24%)
		TPR repeat	57..87	CDD:276809	7/29 (24%)
		TPR 2	58..91		8/32 (25%)
		TPR 3	92..125		8/33 (24%)
		TPR repeat	92..120	CDD:276809	5/28 (18%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900