DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Spag1 and Aip

DIOPT Version :9

Sequence 1:	NP_651514.1	Gene:	Spag1 / 43239	FlyBaseID:	FBgn0039463	Length:	469	Species:	Drosophila melanogaster
Sequence 2:	NP_001263213.1	Gene:	Aip / 11632	MGIID:	109622	Length:	330	Species:	Mus musculus

Alignment Length:	76	Identity:	18/76 - (23%)
Similarity:	36/76 - (47%)	Gaps:	2/76 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   269 NRAVAHLKLKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDFEPDNAI 333
            |.....|..::|:..:..|.:.|.....|:||:.:..:||.|.....|:...:.|:|:.:|  |:
Mouse   236 NYCQCKLVAQEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDP--AL 298

  Fly   334 AKKAVEKLTSM 344
            |.....:|.::
Mouse   299 APVVSRELRAL 309

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Spag1	NP_651514.1	TPR_11	229..295	CDD:290150	5/25 (20%)
		TPR repeat	229..257	CDD:276809
		TPR repeat	262..293	CDD:276809	5/23 (22%)
		TPR_11	266..329	CDD:290150	14/59 (24%)
		TPR	266..297	CDD:197478	5/27 (19%)
		TPR repeat	298..326	CDD:276809	7/27 (26%)
Aip	NP_001263213.1	FKBP_C	29..>90	CDD:418595
		TPR 1. /evidence=ECO:0000255	179..212
		TPR repeat	181..225	CDD:276809
		TPR repeat	230..260	CDD:276809	5/23 (22%)
		TPR 2. /evidence=ECO:0000250\|UniProtKB:O00170	231..264		5/27 (19%)
		TPR 3. /evidence=ECO:0000255, ECO:0000255\|PROSITE-ProRule:PRU00339	265..298		9/34 (26%)
		TPR repeat	265..293	CDD:276809	7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R1535
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030