DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and fkbpl

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_001923918.1 Gene:fkbpl / 100149636 ZFINID:ZDB-GENE-030131-4744 Length:361 Species:Danio rerio


Alignment Length:189 Identity:41/189 - (21%)
Similarity:76/189 - (40%) Gaps:59/189 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 DEEILRMDLNEERDQEQREKIISNHSKSVTTDKLQSERDSLYERLQ-AQLKNLSQLEKEQFAERH 232
            ||.:...:.||:.|:::.|...|.:..::..::.::.:..|:..|. .||| |.||.|.:     
Zfish   226 DETLKEDEENEDEDEDEDEGAESPNDSTIPNEEYKTVKAELHCNLSLCQLK-LGQLGKSK----- 284

  Fly   233 RLRGNESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMN 297
                :.|.||.|             .:|::....|.:.                 |||||:    
Zfish   285 ----DSSIKATE-------------LNPKSTKAWYRHG-----------------QACLQL---- 311

  Fly   298 IKAHLRMAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEKLTSMLGEVAPSSATRL 356
                          |:..||...:.|:|:.:||:|.|:.|::::.|.|.::......||
Zfish   312 --------------GELEESRMAFGKILELQPDSASARTALKQVNSKLKDLDSKLGQRL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 11/65 (17%)
TPR repeat 229..257 CDD:276809 4/27 (15%)
TPR repeat 262..293 CDD:276809 5/30 (17%)
TPR_11 266..329 CDD:290150 11/62 (18%)
TPR 266..297 CDD:197478 6/30 (20%)
TPR repeat 298..326 CDD:276809 4/27 (15%)
fkbplXP_001923918.1 TPR_11 263..329 CDD:290150 25/123 (20%)
TPR repeat 264..292 CDD:276809 12/37 (32%)
TPR repeat 297..327 CDD:276809 11/64 (17%)
TPR_8 299..330 CDD:289924 11/65 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.