DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and aip

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001096219.1 Gene:aip / 100124770 XenbaseID:XB-GENE-947114 Length:328 Species:Xenopus tropicalis


Alignment Length:181 Identity:38/181 - (20%)
Similarity:64/181 - (35%) Gaps:36/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 RMDLNEERDQEQREKIISNHSKSVTTDKLQSERDS---LYERLQAQLKNLSQLEKEQFAERHRLR 235
            |.|.....|||:.|.:...|.:.....|.....|:   .||.: |.||:|..  |||       .
 Frog   163 RQDAWAMTDQEKMEAVPVLHQEGNQLYKQGKTNDAAAKYYEAI-ACLKSLQM--KEQ-------P 217

  Fly   236 GNESFKAKEYENA---IEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMN 297
            |:..:.|.:.:..   :....|.::..                   .|:..:..|.:.|.....|
 Frog   218 GSPDWIALDLKITPLLLNYCQCKLLEG-------------------DYYQVLEHCSSILNKYSDN 263

  Fly   298 IKAHLRMAEAHNAEGKHLESLNVYKKLLDFEPDNA-IAKKAVEKLTSMLGE 347
            :||..:...||.|.....|:...:.:.:..:|..| :..|.::||...|.|
 Frog   264 VKALFKRGRAHAAVWNASEAERDFSRAVSLDPSLAPLVAKEMKKLEERLHE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 6/68 (9%)
TPR repeat 229..257 CDD:276809 3/30 (10%)
TPR repeat 262..293 CDD:276809 3/30 (10%)
TPR_11 266..329 CDD:290150 10/62 (16%)
TPR 266..297 CDD:197478 3/30 (10%)
TPR repeat 298..326 CDD:276809 6/27 (22%)
aipNP_001096219.1 FKBP_C 28..>89 CDD:388582
3a0801s09 169..>320 CDD:273380 36/175 (21%)
TPR repeat 180..206 CDD:276809 5/26 (19%)
TPR repeat 229..259 CDD:276809 4/48 (8%)
TPR repeat 264..292 CDD:276809 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1535
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.