DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and spag1

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001361690.1 Gene:spag1 / 100038144 XenbaseID:XB-GENE-853609 Length:915 Species:Xenopus tropicalis


Alignment Length:483 Identity:133/483 - (27%)
Similarity:222/483 - (45%) Gaps:85/483 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLERYNIPIHYLDFAHVEKCTNAREMEKIVQILRSGEEGHYPDLQRCAEEKLKALKPDSKLFRYE 73
            :.:.:.||:.:||::.:|.|::.:.:|||:.:||||||||||:|....||::..|.|.|:..|.:
 Frog    14 MTKTHQIPVDHLDYSFIENCSDIKHLEKILWVLRSGEEGHYPELIVFCEERIGNLAPHSRALRKD 78

  Fly    74 EQIKQSTDLDKTELKPILDWTDAIKTKDNALNELKKVKQN--------LNLPSVRKLSKIDLEK- 129
            :....::|....      |||:........|.::|..:||        .||||:|..:.:..:. 
 Frog    79 KPSATASDFSSE------DWTNIANDLKEWLVDMKMKEQNESVIPPDTENLPSIRSYTSLPADNK 137

  Fly   130 ---ESKTEKPKPAPKATSPSNTKNKEARIKSTDYRKWDKYDPDEEILRMDLNEERDQEQREKIIS 191
               :.:|...|.||:                 |||.|||:|.::|:.:::.|.|..|:       
 Frog   138 QRGKERTGLSKKAPR-----------------DYRDWDKFDVEKELSKIEDNPETKQQ------- 178

  Fly   192 NHSKSVTTDKLQSERDSLYERLQAQLKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCSI 256
              ||:....|..:.:.:|      ....||..::...||..:.:|||:|::.:|:.||..|:.||
 Frog   179 --SKTTINPKTSAIKKTL------DTAGLSPTQRRFIAENEKEKGNEAFRSGDYQEAIVYYSRSI 235

  Fly   257 IYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVY 321
            ...|..|  ||||||.|.:||..:..|::||:..|::||.|.||:||.|.||.....:..:....
 Frog   236 SVFPSAA--AYNNRAQAEIKLSNWRKALNDCERVLELDPGNTKAYLRRATAHKNLANYKAATTDL 298

  Fly   322 KKLLDFEPDNAIAKK---AVEKLTSMLGEVAPSSATRLIIEEIDPPQLKTSEPKKEAEKSEPTVV 383
            .::|..||||.:|||   .||:|.....|.:.....:::||:|:           .:::.|..|.
 Frog   299 NRVLSQEPDNPVAKKEFAEVEELLQKAEEASRCKGRKIVIEDIE-----------GSDEDEAGVS 352

  Fly   384 KKPEPV-------VSAKKPPPIKDYDLAELVKPNRMVKSNLVSAAEALGNKMQASKGGAPKKPQS 441
            ...||.       .:..||.|.|:...:|........::         |.|.....|..|:||..
 Frog   353 VGGEPAGEHSDMGNAHNKPFPKKNCPRSEECGAPSHTQN---------GVKKDCGNGQQPRKPCE 408

  Fly   442 PPMTPKETLLRLPQDNLNNSNKLLIQEI 469
            .....:.   |:|.....|:.|..|:|:
 Frog   409 GDSLKQN---RVPIPGTENTAKSEIKEV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 27/65 (42%)
TPR repeat 229..257 CDD:276809 11/27 (41%)
TPR repeat 262..293 CDD:276809 14/30 (47%)
TPR_11 266..329 CDD:290150 24/62 (39%)
TPR 266..297 CDD:197478 15/30 (50%)
TPR repeat 298..326 CDD:276809 7/27 (26%)
spag1NP_001361690.1 3a0801s09 137..>550 CDD:273380 94/354 (27%)
TPR repeat 208..236 CDD:276809 11/27 (41%)
TPR repeat 240..270 CDD:276809 14/31 (45%)
TPR repeat 275..303 CDD:276809 7/27 (26%)
3a0801s09 <443..>717 CDD:273380
TPR repeat 443..471 CDD:276809
TPR repeat 484..514 CDD:276809
TPR repeat 519..547 CDD:276809
TPR repeat 619..646 CDD:276809
TPR repeat 651..681 CDD:276809
TPR repeat 686..714 CDD:276809
RPAP3_C 789..879 CDD:372776
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6808
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1070087at2759
OrthoFinder 1 1.000 - - FOG0008026
OrthoInspector 1 1.000 - - oto104319
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1535
SonicParanoid 1 1.000 - - X6081
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.