DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14252 and Msantd1

DIOPT Version :10

Sequence 1:NP_651513.1 Gene:CG14252 / 43238 FlyBaseID:FBgn0039462 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001102559.1 Gene:Msantd1 / 498394 RGDID:1565796 Length:278 Species:Rattus norvegicus


Alignment Length:171 Identity:44/171 - (25%)
Similarity:75/171 - (43%) Gaps:15/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 KARRV--WQPAEECIFVDVWEKFASHIQSDRKKMDVYKDMHNEL-QLRGVGILPGDIKSKIESL- 231
            |.||.  |..||....:.|||:|...::..::...||:.|.::| ::.|...|..:||.||.:: 
  Rat    39 KHRRARNWTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMT 103

  Fly   232 --MRTFRAQRDSVGDKSEWIHYSKILKIQTPIDFT---KL-DVFSEHSSSYEDDASWFKELEPKP 290
              .|..:...||.....:|.:|..|.:|...:..:   || |......|:.:.:||    |.|..
  Rat   104 FQYRKLKCMTDSESVPPDWPYYLAIDRILAKVPESCEGKLPDGQQPGPSTSQTEAS----LSPSA 164

  Fly   291 DPDPISHPPSSSDSVVNQFDNKTQPSSPACSEDCFWSDTEP 331
            ...|: :.|.:..|...:|::....||.:.....|.|:..|
  Rat   165 KSTPL-YLPYTQCSYEGRFEDDRSDSSSSLLSLKFRSEERP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14252NP_651513.1 Myb_DNA-bind_4 3..85 CDD:463994
Myb_DNA-bind_4 173..253 CDD:463994 24/85 (28%)
Msantd1NP_001102559.1 Myb_DNA-bind_4 44..125 CDD:463994 21/80 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.