DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and elf1

DIOPT Version :9

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001072854.1 Gene:elf1 / 780315 XenbaseID:XB-GENE-492875 Length:632 Species:Xenopus tropicalis


Alignment Length:247 Identity:77/247 - (31%)
Similarity:108/247 - (43%) Gaps:69/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 QLLKECNFVSVVHKRAEEQ--RKPKQPRIMSANSISTNSGGSLSLEQRIMRKSYQSVKSSDSVES 325
            |.:.|.|..|.:|::.:.:  |||:.||..|                                .:
 Frog   153 QNIYEENLESNLHEQPKRKKGRKPRNPRPES--------------------------------PT 185

  Fly   326 TTSSMNPSNYTTIGSGNNGQVQLWQFLLEILTD---CEHTDVIEWVGTE-GEFKLTDPDRVARLW 386
            ||.:::.......|.||.  :.||:|||.:|.|   |  ...|:|...| |.|||.|...|:|||
 Frog   186 TTPNISVKKKNKDGKGNT--IYLWEFLLALLQDKATC--PKYIKWTQREKGIFKLVDSKAVSRLW 246

  Fly   387 GEKKNKPAMNYEKLSRALRYYYDGDMISKVSGKRFAYKFDCDLKLLIGYDANELST-------LV 444
            |:.||||.||||.:.|||||||...:::||.|:|..|:|....|.|:..|..:.|:       |.
 Frog   247 GKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLVYIDEEDSSSGAEYSGNLS 311

  Fly   445 SE------GKTAPER--------------VAATETITEDTXHGELKLKEEPD 476
            ||      ..|.|.|              .|::.|:.::.....||||||.|
 Frog   312 SEFSLQHSSVTTPTRNQARASKGSSNTASRASSATVLKNGSSKSLKLKEEID 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472
SAM_PNT-GABP-alpha 184..272 CDD:176084 3/8 (38%)
ETS 345..429 CDD:197710 42/87 (48%)
elf1NP_001072854.1 Elf-1_N 2..110 CDD:372034
ETS 203..285 CDD:197710 41/85 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.