Sequence 1: | NP_001263000.1 | Gene: | Ets97D / 43236 | FlyBaseID: | FBgn0004510 | Length: | 484 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001072854.1 | Gene: | elf1 / 780315 | XenbaseID: | XB-GENE-492875 | Length: | 632 | Species: | Xenopus tropicalis |
Alignment Length: | 247 | Identity: | 77/247 - (31%) |
---|---|---|---|
Similarity: | 108/247 - (43%) | Gaps: | 69/247 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 263 QLLKECNFVSVVHKRAEEQ--RKPKQPRIMSANSISTNSGGSLSLEQRIMRKSYQSVKSSDSVES 325
Fly 326 TTSSMNPSNYTTIGSGNNGQVQLWQFLLEILTD---CEHTDVIEWVGTE-GEFKLTDPDRVARLW 386
Fly 387 GEKKNKPAMNYEKLSRALRYYYDGDMISKVSGKRFAYKFDCDLKLLIGYDANELST-------LV 444
Fly 445 SE------GKTAPER--------------VAATETITEDTXHGELKLKEEPD 476 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ets97D | NP_001263000.1 | GABP-alpha | 48..123 | CDD:288472 | |
SAM_PNT-GABP-alpha | 184..272 | CDD:176084 | 3/8 (38%) | ||
ETS | 345..429 | CDD:197710 | 42/87 (48%) | ||
elf1 | NP_001072854.1 | Elf-1_N | 2..110 | CDD:372034 | |
ETS | 203..285 | CDD:197710 | 41/85 (48%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |