DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and erfl1

DIOPT Version :9

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_009290629.1 Gene:erfl1 / 558126 ZFINID:ZDB-GENE-090529-3 Length:473 Species:Danio rerio


Alignment Length:108 Identity:53/108 - (49%)
Similarity:71/108 - (65%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 YTTIGSGNNGQVQLWQFLLEILTDCEHTDVIEWVGTEGEFKLTDPDRVARLWGEKKNKPAMNYEK 399
            |....|..:.|:|||.|:||:|...|:..||.|.|..|||.:.|||.||||||.:|.||.|||:|
Zfish    30 YKPESSPGSRQIQLWHFILELLQKEEYQGVIAWQGDYGEFVIKDPDEVARLWGIRKCKPHMNYDK 94

  Fly   400 LSRALRYYYDGDMISKVSGKRFAYKFDCDLKLLIGYDANELST 442
            |||||||||:..::.|..||||.|||:....:|:.|...::::
Zfish    95 LSRALRYYYNKRILHKTKGKRFTYKFNFSKVVLVNYPLLDMAS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 49/83 (59%)
erfl1XP_009290629.1 ETS 40..122 CDD:197710 49/81 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.