DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and etsrp

DIOPT Version :9

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001032452.1 Gene:etsrp / 555766 ZFINID:ZDB-GENE-050622-14 Length:366 Species:Danio rerio


Alignment Length:163 Identity:69/163 - (42%)
Similarity:93/163 - (57%) Gaps:14/163 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 IMRKSYQSVKSSDSVESTTSSMNPSNYTTIGSGNNGQVQLWQFLLEILTDCEHTDVIEWVGTEGE 373
            :.|:|....:|....|.|..|..|         .:|.:||||||||:|.|......|.|.|...|
Zfish   213 VKRRSAPPQRSDREGEITPMSAYP---------GSGPIQLWQFLLELLLDSACHTFISWTGDGWE 268

  Fly   374 FKLTDPDRVARLWGEKKNKPAMNYEKLSRALRYYYDGDMISKVSGKRFAYKFDCDLKLLIGYDAN 438
            ||::||..||:.||:.||||.||||||||.|||||..::|.|.:|||:.|:|.||::.::|..|:
Zfish   269 FKMSDPAEVAKRWGQCKNKPKMNYEKLSRGLRYYYHKNIIHKTAGKRYVYRFVCDVQGMLGKTAH 333

  Fly   439 EL--STLVSEGKTAPERVAAT---ETITEDTXH 466
            |:  |..:|....:|:.||.|   |..||.. |
Zfish   334 EVLASLNISPNAASPQSVANTSRSEETTESWTH 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 47/83 (57%)
etsrpNP_001032452.1 ETS 240..323 CDD:197710 46/82 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.