DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and ERFL

DIOPT Version :10

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001352032.1 Gene:ERFL / 390937 HGNCID:53894 Length:354 Species:Homo sapiens


Alignment Length:101 Identity:53/101 - (52%)
Similarity:67/101 - (66%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 YTTIGSGNNGQVQLWQFLLEILTDCEHTDVIEWVGTEGEFKLTDPDRVARLWGEKKNKPAMNYEK 399
            |....|..:.|:|||.|:||:|...|:..||.|.|..|||.:.|||.||||||.:|.||.|||:|
Human    31 YKPESSPGSRQIQLWHFILELLQKEEYQGVIAWQGDYGEFVIKDPDEVARLWGIRKCKPHMNYDK 95

  Fly   400 LSRALRYYYDGDMISKVSGKRFAYKFDCDLKLLIGY 435
            |||||||||:..::.|..||||.|||:....:|:.|
Human    96 LSRALRYYYNKRILHKTKGKRFTYKFNFSKVVLVNY 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:463311
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 49/83 (59%)
ERFLNP_001352032.1 ETS 41..123 CDD:197710 49/81 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..354
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.