DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and Etv2

DIOPT Version :9

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_038949886.1 Gene:Etv2 / 361544 RGDID:1310603 Length:368 Species:Rattus norvegicus


Alignment Length:107 Identity:52/107 - (48%)
Similarity:69/107 - (64%) Gaps:4/107 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 SSDSVESTTSSMNPSNYTTIGSGNNGQVQLWQFLLEILTDCEHTDVIEWVGTEGEFKLTDPDRVA 383
            |..|.:|..:::.|.:.|    .:.|.:||||||||:|.|...:..|.|.|...||:|.||..||
  Rat   244 SKSSQQSDRATLTPYSKT----NHRGPIQLWQFLLELLHDGARSSCIRWTGNNREFQLCDPKEVA 304

  Fly   384 RLWGEKKNKPAMNYEKLSRALRYYYDGDMISKVSGKRFAYKF 425
            |||||:|.||.||||||||.|||||..|::.|..|:::.|:|
  Rat   305 RLWGERKRKPGMNYEKLSRGLRYYYRRDIVLKSGGRKYTYRF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 46/81 (57%)
Etv2XP_038949886.1 ETS 266..348 CDD:197710 46/81 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.