DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and Etv3

DIOPT Version :10

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001099920.1 Gene:Etv3 / 295297 RGDID:1311577 Length:513 Species:Rattus norvegicus


Alignment Length:102 Identity:52/102 - (50%)
Similarity:65/102 - (63%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 YTTIGSGNNGQVQLWQFLLEILTDCEHTDVIEW-VGTEGEFKLTDPDRVARLWGEKKNKPAMNYE 398
            |....|..:.|:|||.|:||:|...|...||.| .|..|||.:.|||.||||||.:|.||.|||:
  Rat    24 YKAESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYD 88

  Fly   399 KLSRALRYYYDGDMISKVSGKRFAYKFDCDLKLLIGY 435
            ||||||||||:..::.|..||||.|||:....::..|
  Rat    89 KLSRALRYYYNKRILHKTKGKRFTYKFNFSKLVMPNY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:463311
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 49/84 (58%)
Etv3NP_001099920.1 ETS 34..120 CDD:197710 49/85 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.