DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and Erf

DIOPT Version :9

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_008757139.1 Gene:Erf / 292721 RGDID:1311991 Length:553 Species:Rattus norvegicus


Alignment Length:101 Identity:53/101 - (52%)
Similarity:68/101 - (67%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 YTTIGSGNNGQVQLWQFLLEILTDCEHTDVIEWVGTEGEFKLTDPDRVARLWGEKKNKPAMNYEK 399
            |....|..:.|:|||.|:||:|...|:..||.|.|..|||.:.|||.||||||.:|.||.|||:|
  Rat    17 YKPESSPGSRQIQLWHFILELLRKEEYQGVIAWQGDYGEFVIKDPDEVARLWGVRKCKPQMNYDK 81

  Fly   400 LSRALRYYYDGDMISKVSGKRFAYKFDCDLKLLIGY 435
            |||||||||:..::.|..||||.|||:.:..:|:.|
  Rat    82 LSRALRYYYNKRILHKTKGKRFTYKFNFNKLVLVNY 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 49/83 (59%)
ErfXP_008757139.1 ETS 27..112 CDD:197710 49/84 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.