DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and Fev

DIOPT Version :10

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_653354.2 Gene:Fev / 246271 RGDID:628860 Length:237 Species:Rattus norvegicus


Alignment Length:84 Identity:57/84 - (67%)
Similarity:69/84 - (82%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 NGQVQLWQFLLEILTDCEHTDVIEWVGTEGEFKLTDPDRVARLWGEKKNKPAMNYEKLSRALRYY 407
            :||:||||||||:|.|..:...|.|.|..|||||||||.|||.|||:|:||.|||:|||||||||
  Rat    44 SGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYY 108

  Fly   408 YDGDMISKVSGKRFAYKFD 426
            ||.:::|||.|||:||:||
  Rat   109 YDKNIMSKVHGKRYAYRFD 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:463311
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 56/82 (68%)
FevNP_653354.2 ETS 46..131 CDD:197710 56/82 (68%)
May mediate active transcriptional repression. /evidence=ECO:0000250 129..237
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.