DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and ELK4

DIOPT Version :9

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001964.2 Gene:ELK4 / 2005 HGNCID:3326 Length:431 Species:Homo sapiens


Alignment Length:147 Identity:55/147 - (37%)
Similarity:80/147 - (54%) Gaps:28/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 VQLWQFLLEILTDCEHTDVIEWVGTEGEFKLTDPDRVARLWGEKKNKPAMNYEKLSRALRYYYDG 410
            :.||||||::|...::..:|.|...:|:|||...:.||||||.:||||.|||:||||||||||..
Human     5 ITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVK 69

  Fly   411 DMISKVSGKRFAYKF-------------------DCDLKLLIGYDANELST----LVSEGKTAPE 452
            ::|.||:|::|.|||                   ||:     ..:.:|:|:    :.:.||..|.
Human    70 NIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCE-----SLNFSEVSSSSKDVENGGKDKPP 129

  Fly   453 RVAATETITEDTXHGEL 469
            :..|..:...|..|..|
Human   130 QPGAKTSSRNDYIHSGL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 46/101 (46%)
ELK4NP_001964.2 ETS 17..88 CDD:197710 37/70 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..139 5/24 (21%)
Herpes_DNAp_acc <237..323 CDD:282746
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..282
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..323
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.