DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and F19F10.1

DIOPT Version :10

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_504949.2 Gene:F19F10.1 / 184684 WormBaseID:WBGene00017598 Length:210 Species:Caenorhabditis elegans


Alignment Length:87 Identity:36/87 - (41%)
Similarity:54/87 - (62%) Gaps:1/87 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 SGNNGQVQLWQFLLEILTDCEHTDVIEWVG-TEGEFKLTDPDRVARLWGEKKNKPAMNYEKLSRA 403
            |...|:::|..||.::|.|..::|:|.|.. :|..||::.|.:||.|||.....|.|||:|:||.
 Worm     6 SSPTGKLRLLSFLRDLLEDESNSDIIYWFDKSESVFKMSKPHKVAELWGAATGNPGMNYDKMSRG 70

  Fly   404 LRYYYDGDMISKVSGKRFAYKF 425
            |||:|..:.:.||.||...|:|
 Worm    71 LRYFYTNNTLEKVPGKDARYRF 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:463311
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 34/82 (41%)
F19F10.1NP_504949.2 ETS 11..97 CDD:197710 34/82 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.