DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and ets-9

DIOPT Version :10

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001371009.1 Gene:ets-9 / 180702 WormBaseID:WBGene00016865 Length:225 Species:Caenorhabditis elegans


Alignment Length:67 Identity:24/67 - (35%)
Similarity:37/67 - (55%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 GQVQLWQFLLEILTDCEHTDVIEWVGTEGEFKLTDPDRVARLWGEKK-NKPAMNYEKLSRALRYY 407
            |..:|..||:.:..:......:.|.|...||.|.:.:.||::||.:| |...|:|.|||||:|..
 Worm    83 GPSRLIGFLVHLAMNERARKALRWTGNGLEFVLVNKELVAKMWGNRKHNTKDMDYYKLSRAIREK 147

  Fly   408 YD 409
            |:
 Worm   148 YE 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:463311
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 23/66 (35%)
ets-9NP_001371009.1 Ets 86..>150 CDD:470627 23/64 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.