DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and Elk1

DIOPT Version :10

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_031948.4 Gene:Elk1 / 13712 MGIID:101833 Length:429 Species:Mus musculus


Alignment Length:97 Identity:51/97 - (52%)
Similarity:65/97 - (67%) Gaps:13/97 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 MNPSNYTTIGSGNNGQVQLWQFLLEILTDCEHTDVIEWVGTE-GEFKLTDPDRVARLWGEKKNKP 393
            |:||            |.||||||::|.:..:..:|.|...: |||||.|.:.||||||.:|||.
Mouse     1 MDPS------------VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKT 53

  Fly   394 AMNYEKLSRALRYYYDGDMISKVSGKRFAYKF 425
            .|||:|||||||||||.::|.||||::|.|||
Mouse    54 NMNYDKLSRALRYYYDKNIIRKVSGQKFVYKF 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:463311
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 48/82 (59%)
Elk1NP_031948.4 ETS 4..89 CDD:197710 49/94 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..146
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..204
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..253
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..354
Sufficient for interaction with MAD2L2. /evidence=ECO:0000250|UniProtKB:P19419 350..400
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.