DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets97D and aop

DIOPT Version :10

Sequence 1:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_061510606.1 Gene:aop / 1271263 VectorBaseID:AGAMI1_001368 Length:914 Species:Anopheles gambiae


Alignment Length:151 Identity:50/151 - (33%)
Similarity:78/151 - (51%) Gaps:27/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 IMSANSISTNSGGSLSLEQRIMRKSYQSVKSSDSVESTTSSMNP-----------SNYTTIGSGN 342
            ::.....::|.|||            .....|.|..||..:..|           .|..:.||.:
Mosquito   404 VLGLKGAASNGGGS------------SGSSGSGSAPSTPGAFLPVKREFFPDSPEPNTISSGSLS 456

  Fly   343 NGQVQLWQFLLEILTD--CEHTDVIEWVGTE-GEFKLTDPDRVARLWGEKKNKPAMNYEKLSRAL 404
            :|:: ||.||.::|.|  ..::..|.|...: |.||:.||..:|:|||::||..:|||:|:||||
Mosquito   457 DGRL-LWDFLQQLLNDPSQRYSSYIAWKCRDTGVFKIVDPAGLAKLWGKQKNHLSMNYDKMSRAL 520

  Fly   405 RYYYDGDMISKVSGKRFAYKF 425
            ||||..:::.||.|:|..|:|
Mosquito   521 RYYYRVNILRKVQGERHCYQF 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:463311
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 37/84 (44%)
aopXP_061510606.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.