DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and gsx1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001039254.1 Gene:gsx1 / 734120 XenbaseID:XB-GENE-855502 Length:243 Species:Xenopus tropicalis


Alignment Length:183 Identity:56/183 - (30%)
Similarity:73/183 - (39%) Gaps:57/183 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 YPQHPSQQHQQHHHHHHHPPQLVHQKLSYV--------------SPPPAIAAGGAANPVLPHAF- 163
            |..||:      |..|..|....|.:.|.:              .|||.|       |:|..:| 
 Frog    29 YAVHPT------HPLHGLPAGSCHSRKSGLLCVCPMCVTASHLHPPPPGI-------PLLKASFS 80

  Fly   164 -------PAGFPSDPHFSAGFSA------FLARRRRKEGRQ----------------RRQRTTFS 199
                   |||.......|.|.:.      :.|.....:.||                :|.||.|:
 Frog    81 SFGTQYCPAGLGRQHSASTGINVSHGPALYQAAYPLPDPRQFHCISVDSSPSQLSSSKRMRTAFT 145

  Fly   200 TEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKA 252
            :.|.|.||.||..|.|:||.||.|:|..|.|:|.|:||||||||.|.|:..|:
 Frog   146 STQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKS 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
gsx1NP_001039254.1 homeobox 137..196 32/58 (55%)
Homeobox 141..194 CDD:365835 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.