DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxa6

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001178016.1 Gene:Hoxa6 / 685732 RGDID:1590236 Length:233 Species:Rattus norvegicus


Alignment Length:206 Identity:63/206 - (30%)
Similarity:82/206 - (39%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PYHSDGGSVSSPDISIS-----DERTSLAA-------YPAYDFYGHAKDY----PQHPSQQHQQH 125
            |:.:..|:.|.||.:.:     .:..|:.|       |.|..||.. ||.    |...|:|....
  Rat    37 PFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSD-KDLSGASPSGNSKQRGPG 100

  Fly   126 HHHHHHPPQLVHQKLSYVSPPPAIAAGGA----------ANPVLPHAFPAGFPSDPHFSAGFSAF 180
            .:.|..|.|       ...|..:...|.|          .:||.|                   :
  Rat   101 DYLHFSPEQ-------QYKPDSSSVQGKALHEEGTDRKYTSPVYP-------------------W 139

  Fly   181 LARRRRKEG-----RQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQ 240
            :.|.....|     ..||.|.|::..|||.||.|||.|.|::|.||.|:|..|.|||.|||||||
  Rat   140 MQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQ 204

  Fly   241 NRRAKDKRIEK 251
            |||.|.|:..|
  Rat   205 NRRMKWKKENK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 31/50 (62%)
Hoxa6NP_001178016.1 Homeobox 159..212 CDD:395001 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.