DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and ceh-63

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001123094.1 Gene:ceh-63 / 6418830 WormBaseID:WBGene00045215 Length:152 Species:Caenorhabditis elegans


Alignment Length:195 Identity:53/195 - (27%)
Similarity:75/195 - (38%) Gaps:80/195 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 AYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSPPPAIAAGGAANPVLPHAFPAGFP 168
            ||||:..:.|  .:.|||                  :..:.|||                     
 Worm    13 AYDFFPWSND--TNSSQQ------------------IKNIKPPP--------------------- 36

  Fly   169 SDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTET 233
                              |...:..:||||::||...||:||.:||||.:.||.|||:|:.|||.
 Worm    37 ------------------KRSNRPTKRTTFTSEQVTLLELEFAKNEYICKDRRGELAQTIELTEC 83

  Fly   234 QIKIWFQNRRAKDKR----IEKAQI--------------DQHYRNFVVANGFMSSIMGQAATTMP 280
            |:|.||||||.|.:|    :.|:.:              .||.:|.   ..|..|.....|.::|
 Worm    84 QVKTWFQNRRTKKRRCTSPLRKSMMKKSDERSPSPQNPSSQHVQNL---QTFFHSWPSHFAYSLP 145

  Fly   281  280
             Worm   146  145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 31/50 (62%)
ceh-63NP_001123094.1 Homeobox 44..98 CDD:365835 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.