DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxa4a

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_571610.1 Gene:hoxa4a / 58050 ZFINID:ZDB-GENE-000823-4 Length:245 Species:Danio rerio


Alignment Length:210 Identity:65/210 - (30%)
Similarity:89/210 - (42%) Gaps:50/210 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PPCDTPYHSDG-GSVSS--------PDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHH 127
            |||: .||.:| ..|||        |.....:|    |:||..::...:.||....:........
Zfish    18 PPCE-EYHQNGYMPVSSDYYERPKDPGFPHHEE----ASYPRSNYQEQSYDYGNVSTNDLNDFSD 77

  Fly   128 HHHHPPQLVHQK------------------LSYVSPPPAIAAGGAANPVLPHAFPAGFPSDPH-- 172
            .||..||.|.|.                  .|.||.    |..|:.....|..:|  :....|  
Zfish    78 RHHAQPQSVSQNHGPRLTTESCVGSDGNKDCSLVSD----ALPGSQKSKEPVVYP--WMKKVHVN 136

  Fly   173 -FSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIK 236
             .:|.:|.         |..:|.||.::.:|.|.||.|||.|.|::|.||.|:|.|:.|:|.|:|
Zfish   137 TVTASYSG---------GVPKRSRTAYTRQQALELEKEFHFNRYLTRRRRVEIAHTMCLSERQVK 192

  Fly   237 IWFQNRRAKDKRIEK 251
            |||||||.|.|:..|
Zfish   193 IWFQNRRMKWKKDHK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
hoxa4aNP_571610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..99 13/68 (19%)
Antp-type hexapeptide 126..131 1/6 (17%)
Homeobox 150..203 CDD:278475 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..245 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.