DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxa3a

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_571609.1 Gene:hoxa3a / 58049 ZFINID:ZDB-GENE-000823-3 Length:411 Species:Danio rerio


Alignment Length:260 Identity:69/260 - (26%)
Similarity:90/260 - (34%) Gaps:95/260 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DTPYHSDGGSVSSPDISISDERTSLAAYPAYDFYG---------------HAKDYPQHPSQQHQQ 124
            ::.||....|:.||.||.....::..:.......|               .|...|..||..:| 
Zfish    40 ESEYHRPACSLQSPGISAGLHTSNEMSEVCQQINGTQATVTDTSDNKQPPTAPSGPSSPSSLNQ- 103

  Fly   125 HHHHHHHPPQL-------VHQKLSYVSPPPAIAAGGAANPVLPHAFP------------------ 164
                   .|.:       ||     |||.|:         ...|.||                  
Zfish   104 -------IPNIDSAAKNPVH-----VSPTPS---------TRKHIFPWMKESRQNTKQKSCSIIS 147

  Fly   165 ----AGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELA 225
                ||....|..||.              .:|.||.:::.|.:.||.|||.|.|:.|.||.|:|
Zfish   148 VESCAGRQKSPPGSAA--------------SKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMA 198

  Fly   226 ETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVANGFMSSIMGQ---AATTMPPGGVTGG 287
            ..|.|||.||||||||||.|.|:.:|..            |.|.|...|   :..::..||..||
Zfish   199 NLLNLTERQIKIWFQNRRMKYKKDQKGL------------GMMPSPGAQSPHSPVSLSSGGGGGG 251

  Fly   288  287
            Zfish   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
hoxa3aNP_571609.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..126 12/68 (18%)
Antp-type hexapeptide 127..132 2/4 (50%)
Homeobox 168..220 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..250 7/38 (18%)
DUF4074 347..409 CDD:290032
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.