DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxa9b

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_571608.1 Gene:hoxa9b / 58048 ZFINID:ZDB-GENE-000823-2 Length:258 Species:Danio rerio


Alignment Length:219 Identity:59/219 - (26%)
Similarity:79/219 - (36%) Gaps:71/219 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VGTHAHKPPPCDTPYHSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHH 128
            :..|.:...||.|. .|||.||         ...:|...||..|.|.:.|               
Zfish    74 IAYHPYIHHPCSTG-DSDGASV---------RPWALEPLPALPFTGLSTD--------------- 113

  Fly   129 HHHPPQLVHQKLSYVSPPPAIAAG--------------------------GAANPVLPHAFPAGF 167
                   .||.:..   .|.:.:|                          ..:|.......||..
Zfish   114 -------THQDIKL---EPLVGSGECTTHTLLVAETDNNTTQTERKVPDDAVSNGSHDEKIPAET 168

  Fly   168 -----PSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAET 227
                 ||..:.....|.:|..:     ..|::|..::..|||.||.||..|.|:||.||:|:|..
Zfish   169 KLDLDPSKCNQDNPLSNWLHAK-----STRKKRCPYTKHQTLELEKEFLFNMYLSRDRRYEVARL 228

  Fly   228 LRLTETQIKIWFQNRRAKDKRIEK 251
            |.|||.|:||||||||.|.|:..|
Zfish   229 LNLTERQVKIWFQNRRMKMKKCNK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
hoxa9bNP_571608.1 Hox9_act 1..174 CDD:282473 22/134 (16%)
Homeobox 195..248 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.