Sequence 1: | NP_524521.1 | Gene: | ro / 43234 | FlyBaseID: | FBgn0003267 | Length: | 350 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005172831.1 | Gene: | hoxc6b / 58045 | ZFINID: | ZDB-GENE-000822-1 | Length: | 228 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 57/204 - (27%) |
---|---|---|---|
Similarity: | 78/204 - (38%) | Gaps: | 57/204 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 HSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYV 143
Fly 144 SPPPAIAAGGAANP-------------VLP----------------HAFPAGFPSDPHFSAGFSA 179
Fly 180 FLARRRRKEG-----RQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWF 239
Fly 240 QNRRAKDKR 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ro | NP_524521.1 | Homeobox | 196..247 | CDD:278475 | 31/50 (62%) |
hoxc6b | XP_005172831.1 | Homeobox | 140..192 | CDD:278475 | 32/51 (63%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |