DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxc9a

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_571603.3 Gene:hoxc9a / 58043 ZFINID:ZDB-GENE-000328-5 Length:270 Species:Danio rerio


Alignment Length:230 Identity:64/230 - (27%)
Similarity:89/230 - (38%) Gaps:71/230 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 ISISDERTSL----AAYPAYDFYGHAKDYPQHPSQQHQQH---HHHHHHPPQL---VHQKLSYVS 144
            ||.|...|.|    |.||:..|......:....:..|.|.   :|.:.|.|.|   .....|::.
Zfish    44 ISSSSRPTPLVPECADYPSCSFAPKPPVFTTSWAPVHSQSSVVYHPYTHQPHLGTDSRYVRSWLE 108

  Fly   145 PPPAIAA--GGAANP----VLPHAFPAGFPSDPHFSAG---------------FSAFLARRRRK- 187
            |.|...:  |.|.|.    :.|..|     .||.  ||               .||...|.::: 
Zfish   109 PIPGTVSFPGYAGNSRHYGLKPDTF-----QDPR--AGDCLGSNGRTYTDYLYCSAVDIREKQQN 166

  Fly   188 ----------EGRQ----------------------RRQRTTFSTEQTLRLEVEFHRNEYISRSR 220
                      .|:.                      |::|..::..|||.||.||..|.|::|.|
Zfish   167 TPSPETESLSSGKHKDDKAELDPNNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDR 231

  Fly   221 RFELAETLRLTETQIKIWFQNRRAKDKRIEKAQID 255
            |:|:|..|.|||.|:||||||||.|.|::.|.:.|
Zfish   232 RYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKND 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
hoxc9aNP_571603.3 Hox9_act 11..189 CDD:398350 31/151 (21%)
HOX 202..251 CDD:197696 24/48 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.