DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxb4

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001116487.1 Gene:hoxb4 / 548393 XenbaseID:XB-GENE-1033882 Length:234 Species:Xenopus tropicalis


Alignment Length:202 Identity:64/202 - (31%)
Similarity:89/202 - (44%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPPCDTPYHSDG-GSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQH-------- 125
            |.|||:...|:|. .|..||:.....:|.|        .:.|...|.:..|.....:        
 Frog    16 KFPPCEEYSHTDYLPSGHSPEYYGGQKRES--------SFQHGAPYSRSLSSSSAPYTSCQGSVR 72

  Fly   126 ------HHHHHHPPQLVH--QKLSYVSPPP-AIAAGGAANPVLPHAFPAGFP--SDPHFSAGFSA 179
                  |.....|.:..|  ..::..|||. ::.|....:|..|...|..:|  ...|.|...|.
 Frog    73 QGARLPHSSGLLPGEKAHLESSITPTSPPSCSLIASDHKHPDSPGQDPVVYPWMKKAHISRASST 137

  Fly   180 FLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRA 244
            :      .:|..:|.||.::.:|.|.||.|||.|.|::|.||.|:|.||||:|.||||||||||.
 Frog   138 Y------SDGEAKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLRLSERQIKIWFQNRRM 196

  Fly   245 KDKRIEK 251
            |.|:..|
 Frog   197 KWKKDHK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 31/50 (62%)
hoxb4NP_001116487.1 Homeobox 146..200 CDD:365835 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.