Sequence 1: | NP_524521.1 | Gene: | ro / 43234 | FlyBaseID: | FBgn0003267 | Length: | 350 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001116487.1 | Gene: | hoxb4 / 548393 | XenbaseID: | XB-GENE-1033882 | Length: | 234 | Species: | Xenopus tropicalis |
Alignment Length: | 202 | Identity: | 64/202 - (31%) |
---|---|---|---|
Similarity: | 89/202 - (44%) | Gaps: | 34/202 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 KPPPCDTPYHSDG-GSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQH-------- 125
Fly 126 ------HHHHHHPPQLVH--QKLSYVSPPP-AIAAGGAANPVLPHAFPAGFP--SDPHFSAGFSA 179
Fly 180 FLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRA 244
Fly 245 KDKRIEK 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ro | NP_524521.1 | Homeobox | 196..247 | CDD:278475 | 31/50 (62%) |
hoxb4 | NP_001116487.1 | Homeobox | 146..200 | CDD:365835 | 32/53 (60%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |