DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxc8a

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001005771.1 Gene:hoxc8a / 449648 ZFINID:ZDB-GENE-990415-114 Length:250 Species:Danio rerio


Alignment Length:176 Identity:63/176 - (35%)
Similarity:75/176 - (42%) Gaps:44/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 YGHAKDYP--QHPSQQHQQHHHHH----HHPPQLVHQKLSYVSPPPAIAAGGAAN-----PVLP- 160
            |||....|  ||||...|...||.    .:|        .|...|.|:|..|.|.     ..|| 
Zfish    40 YGHGAAAPGFQHPSHHVQDFFHHGTTGISNP--------GYQQNPCALACHGDATKFYGYEALPR 96

  Fly   161 --------HAFPAGFP-------SDP-----HFSAGFSAFLA---RRRRKEGRQRRQRTTFSTEQ 202
                    .|..|.:|       ::|     |.|...|..|.   .|....|| |..|.|:|..|
Zfish    97 QPLYGTQQEATLAQYPDCKSSNSTNPGEGQGHLSQNSSPSLMFPWMRPHAPGR-RNGRQTYSRYQ 160

  Fly   203 TLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKR 248
            ||.||.||..|.|::|.||.|::..|.|||.|:||||||||.|.|:
Zfish   161 TLELEKEFLFNPYLTRKRRIEVSHALSLTERQVKIWFQNRRMKWKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
hoxc8aNP_001005771.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..152 10/40 (25%)
Antp-type hexapeptide. /evidence=ECO:0000255 138..143 0/4 (0%)
Homeobox 153..205 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..250 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.