DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxc8

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001006787.1 Gene:hoxc8 / 448482 XenbaseID:XB-GENE-480999 Length:242 Species:Xenopus tropicalis


Alignment Length:221 Identity:58/221 - (26%)
Similarity:80/221 - (36%) Gaps:66/221 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PSSPRQFFERLYGHLETRSSENGEIDVGTHAHKPPPCDTPYHSDGGSVSSPDISISDERTSLAAY 102
            ||:....|:....|:: ....:|...:.....:..||....|.|.......:           |.
 Frog    42 PSATAPGFQHPSHHVQ-EFFHHGSSSLSNSGFQQNPCALTCHGDASKFYGYE-----------AL 94

  Fly   103 PAYDFYGHAKD-----YPQHPSQQHQ-----QHHHHHHHPPQLVHQKLSYVSPPPAIAAGGAANP 157
            |....||..::     ||...|..:.     |.|.:.:..|.|:                     
 Frog    95 PRQSLYGAQQEASVVQYPDCKSSSNTNTSEGQGHLNQNSSPSLM--------------------- 138

  Fly   158 VLPHAFPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRF 222
                 ||...|..|             .|:.|||     |:|..|||.||.||..|.|::|.||.
 Frog   139 -----FPWMRPHAP-------------GRRSGRQ-----TYSRYQTLELEKEFLFNPYLTRKRRI 180

  Fly   223 ELAETLRLTETQIKIWFQNRRAKDKR 248
            |::..|.|||.|:||||||||.|.|:
 Frog   181 EVSHALGLTERQVKIWFQNRRMKWKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
hoxc8NP_001006787.1 Homeobox 153..206 CDD:365835 31/57 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.