DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and meox1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001002450.2 Gene:meox1 / 436723 ZFINID:ZDB-GENE-040718-149 Length:253 Species:Danio rerio


Alignment Length:214 Identity:54/214 - (25%)
Similarity:77/214 - (35%) Gaps:92/214 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 YPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSPPPAIAAGGAANPVLPHAFP----------AGF- 167
            |.|.|...||:|..       |.:...|.....||           |||:|          :|: 
Zfish    37 YQQAPFALHQKHDF-------LAYTDFSSSCLVPA-----------PHAYPREDRLYPETHSGYQ 83

  Fly   168 -------PSDPH------------------FSAGFSAFL-------------------------A 182
                   |.:|.                  .|||.....                         :
Zfish    84 RTEWQFSPCEPRGRGQEPCQGAAEAVGAEMDSAGGDRLAGAVTGCLEGDYSPQSVPAVDTEKKSS 148

  Fly   183 RRRRK-------------EGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQ 234
            :|:|:             ..:.|::||.|:.||...||.||..:.|::|.||:|:|..|.|||.|
Zfish   149 KRKREVTDIQDSSFKADSNCKARKERTAFTKEQLRELEAEFTHHNYLTRLRRYEIAVNLDLTERQ 213

  Fly   235 IKIWFQNRRAKDKRIEKAQ 253
            :|:||||||.|.||::..|
Zfish   214 VKVWFQNRRMKWKRVKGGQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 27/50 (54%)
meox1NP_001002450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..158 2/21 (10%)
Homeobox 174..226 CDD:278475 28/51 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..253 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.