Sequence 1: | NP_524521.1 | Gene: | ro / 43234 | FlyBaseID: | FBgn0003267 | Length: | 350 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005915.2 | Gene: | MEOX2 / 4223 | HGNCID: | 7014 | Length: | 304 | Species: | Homo sapiens |
Alignment Length: | 258 | Identity: | 81/258 - (31%) |
---|---|---|---|
Similarity: | 113/258 - (43%) | Gaps: | 56/258 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 HSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLS-- 141
Fly 142 ----YVSPPPAIA---------AG-----GAANPV-------LPHAFPAG---FPSDPHFSAGFS 178
Fly 179 AFLARR---RRK-------EG--------RQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELA 225
Fly 226 ETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVAN---GFM--SSIMGQAATTMPPGG 283 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ro | NP_524521.1 | Homeobox | 196..247 | CDD:278475 | 27/50 (54%) |
MEOX2 | NP_005915.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 63..192 | 34/131 (26%) | |
COG5576 | 160..284 | CDD:227863 | 44/123 (36%) | ||
Homeobox | 191..243 | CDD:278475 | 28/51 (55%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |