DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and MEOX1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens


Alignment Length:269 Identity:82/269 - (30%)
Similarity:115/269 - (42%) Gaps:74/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LDPIANTTILSVPQRPSSPRQFFERLYGHLETRSSE-NGEIDVGTHAHKPPPCDTP--YHSDGGS 84
            :||.|::.:.|:  :|.:|      ::|.|....|| ||...:   .|.||   ||  :|     
Human     1 MDPAASSCMRSL--QPPAP------VWGCLRNPHSEGNGASGL---PHYPP---TPFSFH----- 46

  Fly    85 VSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHP--PQLVHQKLSYVSP-- 145
             ..||..    .|:.||||  ||.........| |...::|.....||  ||         ||  
Human    47 -QKPDFL----ATATAAYP--DFSASCLAATPH-SLPQEEHIFTEQHPAFPQ---------SPNW 94

  Fly   146 ----------PPAIAAGGA---ANPVLPHAFPAGFPSDPHFSAGFSA----FLARRRRKE----- 188
                      |.:..|||:   ....|......|.|.|.:...|.:|    ..:.|||||     
Human    95 HFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQ 159

  Fly   189 ---------GRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRA 244
                     .:.|::||.|:.||...||.||..:.|::|.||:|:|..|.|:|.|:|:||||||.
Human   160 ENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRM 224

  Fly   245 KDKRIEKAQ 253
            |.||::..|
Human   225 KWKRVKGGQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 26/50 (52%)
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 23/100 (23%)
Homeobox 175..227 CDD:306543 27/51 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.