DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and ftz

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:357 Identity:90/357 - (25%)
Similarity:128/357 - (35%) Gaps:101/357 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ANTTILSVPQRPSSPRQFFERLYGHLETRSSENGEIDVGTHAHKPPPCDTPYHSDGGSVSSPDIS 91
            |.:.|.:|.:|||:.|.........|:               :.|   |..|.:......:|.:|
  Fly    95 AASIIAAVEERPSTLRALLTNPVKKLK---------------YTP---DYFYTTVEQVKKAPAVS 141

  Fly    92 ISDERTSLAAYPA--YDFYGHAKDYPQHPSQQHQQH-HHHHHHPPQLVHQKL---SYVSPPPAIA 150
                 |.:.|.||  ||     ::|...|:....:. .:...:.||...|||   .:.:|||.. 
  Fly   142 -----TKVTASPAPSYD-----QEYVTVPTPSASEDVDYLDVYSPQSQTQKLKNGDFATPPPTT- 195

  Fly   151 AGGAANPVLPHAFPAGFP-----SDPHFSAGFSAFLARRRRKEGR-------------------- 190
                         |...|     |.|..|.|..:..|..:....|                    
  Fly   196 -------------PTSLPPLEGISTPPQSPGEKSSSAVSQEINHRIVTAPNGAGDFNWSHIEETL 247

  Fly   191 ------QRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRI 249
                  .:|.|.|::..|||.||.|||.|.||:|.||.::|..|.|:|.||||||||||.|.|:.
  Fly   248 ASDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKD 312

  Fly   250 EKAQIDQHYRNFVVANGFMSSIMGQAATTM-PPGGVTGGVAVG---VGLNYYAAAATPAALPKDN 310
            ........:             .|...|.| ||...|.....|   |.:..|....|.||.|..:
  Fly   313 RTLDSSPEH-------------CGAGYTAMLPPLEATSTATTGAPSVPVPMYHHHQTTAAYPAYS 364

  Fly   311 TQDANFIDIDDQFQRQQQQKQ-----QQQQQQ 337
            ...::...:.:.:.:||..:|     ||.|.|
  Fly   365 HSHSHGYGLLNDYPQQQTHQQYDAYPQQYQHQ 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 30/50 (60%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 37/194 (19%)
Homeobox 257..310 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439770
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.