DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and zen

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster


Alignment Length:177 Identity:50/177 - (28%)
Similarity:70/177 - (39%) Gaps:53/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 YHSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDY------PQHPSQQHQQHHHHHHHPPQLV 136
            |.:|...|...|:                .|||..|.      |.:..........:.|..||.|
  Fly    18 YSADPSEVKYSDL----------------IYGHHHDVNPIGLPPNYNQMNSNPTTLNDHCSPQHV 66

  Fly   137 HQKLSYVSPPPAIAAGGAANPVLPHAFPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTE 201
            ||:  :||.                  ....||.|:..:           :..:.:|.||.|::.
  Fly    67 HQQ--HVSS------------------DENLPSQPNHDS-----------QRVKLKRSRTAFTSV 100

  Fly   202 QTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKR 248
            |.:.||.||..|.|:.|:||.|:|:.|.|.|.|:||||||||.|.|:
  Fly   101 QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 27/50 (54%)
zenNP_476793.1 Homeobox 93..146 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439764
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.