DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and pb

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:279 Identity:70/279 - (25%)
Similarity:103/279 - (36%) Gaps:99/279 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IGSPDGSPGIKRSDSLDPIANTTILSVPQRPSSPRQFFERLYGHLETRSSENGEIDVGTHAHKPP 72
            :|...|.|||.:.            .||..||.  ....::..:.:.||:               
  Fly    52 VGVSVGQPGIGQQ------------GVPPVPSV--LMVNKMTPNCDKRSA--------------- 87

  Fly    73 PCDTPY---HSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQ 134
              ||.|   .|:||.::|        :.|:|     :|..|..  |:.|                
  Fly    88 --DTAYWMTASEGGFINS--------QPSMA-----EFLNHLS--PESP---------------- 119

  Fly   135 LVHQKLSYVSPPPAIAAGGA-----ANPVLPHAFPAG-FPSDPHFSAGFSAFLARRRRKEGRQ-- 191
                |:.  :|..:.|.||.     .|..:...:|.| .|..|........:...:.:|..|:  
  Fly   120 ----KIG--TPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDSVPEYPWMKEKKTSRKSS 178

  Fly   192 --------------------RRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIK 236
                                ||.||.::..|.|.||.|||.|:|:.|.||.|:|.:|.|||.|:|
  Fly   179 NNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVK 243

  Fly   237 IWFQNRRAKDKRIEKAQID 255
            :||||||.|.||...::.|
  Fly   244 VWFQNRRMKHKRQTLSKTD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
pbNP_476669.3 COG5576 168..274 CDD:227863 36/95 (38%)
Homeobox 202..254 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439774
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.