DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and mnx2a

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001009886.2 Gene:mnx2a / 406205 ZFINID:ZDB-GENE-040415-1 Length:309 Species:Danio rerio


Alignment Length:174 Identity:61/174 - (35%)
Similarity:82/174 - (47%) Gaps:43/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GSVSSPDISISDERTSLAA-YPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSPP 146
            |...||..||    |:|.| :|::.:.|..:.||.|..                           
Zfish    79 GMYPSPMYSI----TALGAQHPSFAYSGFTQPYPDHLK--------------------------- 112

  Fly   147 PAIAAGGAANPVLPHAFPAG--FPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVE 209
               ||..|.:..|.|...||  .|....:|....:.|.      |:.||.||.|:::|.|.||.:
Zfish   113 ---AAAMAGSLPLEHWLRAGLIMPRLADYSGAPQSGLI------GKCRRPRTAFTSQQLLELENQ 168

  Fly   210 FHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQ 253
            |..|:|:||.:|||:|.:|.|||||:||||||||.|.||..||:
Zfish   169 FKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSRKAK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 30/50 (60%)
mnx2aNP_001009886.2 Homeobox 153..206 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.