DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxb9

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_988879.1 Gene:hoxb9 / 394474 XenbaseID:XB-GENE-963094 Length:247 Species:Xenopus tropicalis


Alignment Length:251 Identity:65/251 - (25%)
Similarity:90/251 - (35%) Gaps:101/251 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHH-------------------- 128
            |:.||:   |:|.      ||..|.|      |:||.:...|..|                    
 Frog    14 SIISPE---SEEA------PAAKFSG------QYPSPRPAAHSAHSEPLDFPSCSFQPKAPVFSA 63

  Fly   129 -----HHHP----PQLVHQKLSYVSPPP------------AIAAGG------AANPVL------- 159
                 :.||    |.:.|..:...:|.|            ..|..|      .:.|:|       
 Frog    64 SWSPLNPHPASPLPSVYHPYIQQGAPTPEGRYLRGWLEPLQRAENGPGQGTVKSEPLLGPPGELD 128

  Fly   160 -----------PHA---------FP-------AGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTT 197
                       |.|         ||       :|.....|.|...:.:|..|     ..|::|..
 Frog   129 KLGAQQYNLGSPAAREDANERATFPDNKLCEGSGDKDRTHQSNPSANWLHAR-----SSRKKRCP 188

  Fly   198 FSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQ 253
            ::..|||.||.||..|.|::|.||.|:|..|.|:|.|:||||||||.|.|::.|.|
 Frog   189 YTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKLNKDQ 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 27/50 (54%)
hoxb9NP_988879.1 Hox9_act 1..169 CDD:368024 29/169 (17%)
Homeobox 185..239 CDD:365835 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.