DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and PDX1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_000200.1 Gene:PDX1 / 3651 HGNCID:6107 Length:283 Species:Homo sapiens


Alignment Length:253 Identity:82/253 - (32%)
Similarity:98/253 - (38%) Gaps:58/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PPPCDTPYHSDGGSV---SSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHP 132
            |||...|:....|::   |.|||| ..|...||..||.                   .|.|||.|
Human    43 PPPPPHPFPGALGALEQGSPPDIS-PYEVPPLADDPAV-------------------AHLHHHLP 87

  Fly   133 PQLVHQKLSYVSPPPAIAAGGAANPVL--PHAFPAGFP----SDPHFSAGFSAFLARRRRKEGRQ 191
            .|     |:...||......||...||  |:.....||    :..|...|..|..|.....| ..
Human    88 AQ-----LALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPE-EN 146

  Fly   192 RRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQ 256
            :|.||.::..|.|.||.||..|:||||.||.|||..|.|||..|||||||||.|.|   |.:..:
Human   147 KRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWK---KEEDKK 208

  Fly   257 HYRNFVVANGFMSS-------IMGQAATTMPPGGVTGGVAVGVGLNYYAAAATPAALP 307
            ......|..|.::.       ..|:....:||....||             |.|.|.|
Human   209 RGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGG-------------AVPPAAP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 31/50 (62%)
PDX1NP_000200.1 Transactivation domain. /evidence=ECO:0000250 13..73 11/30 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..71 11/28 (39%)
Antp-type hexapeptide 118..123 2/4 (50%)
Homeobox 149..202 CDD:278475 32/52 (62%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 4/8 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 13/69 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.