DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Meox1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001102307.1 Gene:Meox1 / 363684 RGDID:1308911 Length:253 Species:Rattus norvegicus


Alignment Length:270 Identity:78/270 - (28%)
Similarity:116/270 - (42%) Gaps:77/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LDPIANTTILSVPQRPSSPRQFFERLYGHLETRSSENGEIDVGTHA----HKPPPCDTPY----H 79
            :||:.|:.:.: ||.|:.       ::|.|....||      |:.|    |.||   ||:    .
  Rat     1 MDPVVNSCVRN-PQPPAP-------VWGCLRNPHSE------GSSASGLPHYPP---TPFSFHQK 48

  Fly    80 SD-GGSVSSPDISIS-----------DERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHP 132
            || ..:.:.||.|.|           .||.....:||         :||.|.         .|.|
  Rat    49 SDFPATAAYPDFSTSCLAATPHSLPRAERIFNEQHPA---------FPQTPD---------WHFP 95

  Fly   133 PQLVHQKLSYVSPPPAIAAGGAANPVLPHAFPAGFPSDPHFSAGFSAF-----LARRRRK----- 187
            .....|:|: :.|..:....||.:|.|...  .|...:.....|..|.     |:||:::     
  Rat    96 ISEAGQRLN-LGPAGSAREMGAGSPGLVDG--TGGLGEDCMVLGTIAHETEKKLSRRKKERSDNP 157

  Fly   188 -------EG--RQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRR 243
                   ||  :.|::||.|:.||...||.||..:.|::|.||:|:|..|.|:|.|:|:||||||
  Rat   158 ENGGGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRR 222

  Fly   244 AKDKRIEKAQ 253
            .|.||::..|
  Rat   223 MKWKRVKGGQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 26/50 (52%)
Meox1NP_001102307.1 COG5576 139..251 CDD:227863 37/94 (39%)
Homeobox 174..227 CDD:395001 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.