DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and unpg

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:356 Identity:90/356 - (25%)
Similarity:127/356 - (35%) Gaps:124/356 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 THAHK-------PPPCDT---PYHSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQ 120
            |||.:       |.|.||   |::.....|:..|:|.    ..||.....| |.|:...  |...
  Fly   138 THALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSY----RRLAELMNQD-YVHSLSV--HARL 195

  Fly   121 QHQ----QHHHHHHHPPQLVHQKLSYVSPPPA---IAAGGAANPVLPHAFPAGFPSDPHFSA--- 175
            ||.    :.|....:|..   .:|...:||.|   .|..|:.:|:.| |...|...|...|.   
  Fly   196 QHMAAAGRMHEDQANPGM---AQLQEPTPPQAHSSPAKSGSHSPMEP-ALDVGMDEDFECSGDSC 256

  Fly   176 ----------GFSAFLARRR--------------------RKEG-----------------RQRR 193
                      .::..:.:.|                    |.||                 :.||
  Fly   257 SDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRR 321

  Fly   194 QRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEK------- 251
            :||.|::||.|.||.|||..:|:|.:.|.::|.:|:|:|.|:||||||||||.||::.       
  Fly   322 RRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGL 386

  Fly   252 ------------AQIDQHYRNFVV--------------------------ANGFMSSIMGQAATT 278
                        ..|..|...|.|                          |.|......|....:
  Fly   387 GRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTNAS 451

  Fly   279 MPPGGVTG-GVAVGVGLNYYAAAATPAALPK 308
            .|.||..| ||.||||:......:||.:|.:
  Fly   452 SPSGGPVGLGVGVGVGVGVGLGVSTPLSLAR 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.