Sequence 1: | NP_524521.1 | Gene: | ro / 43234 | FlyBaseID: | FBgn0003267 | Length: | 350 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062458.1 | Gene: | HOXD8 / 3234 | HGNCID: | 5139 | Length: | 290 | Species: | Homo sapiens |
Alignment Length: | 234 | Identity: | 71/234 - (30%) |
---|---|---|---|
Similarity: | 82/234 - (35%) | Gaps: | 100/234 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 HAH---KPPPCDTP-----------YHSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQH 117
Fly 118 PSQQHQQHHHHHHHPPQLVHQKLSYVSPPPAIAAGGAANPVLPHAFPAGF------PSDPHFSAG 176
Fly 177 FSAFLA--------------------------------RRRRKEGRQRRQRTTFSTEQTLRLEVE 209
Fly 210 FHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKR 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ro | NP_524521.1 | Homeobox | 196..247 | CDD:278475 | 29/50 (58%) |
HOXD8 | NP_062458.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 60..127 | 25/100 (25%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..200 | 4/39 (10%) | |||
Homeobox | 201..253 | CDD:278475 | 30/51 (59%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 255..290 | 71/234 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |