DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and HOXC9

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_008828.1 Gene:HOXC9 / 3225 HGNCID:5130 Length:260 Species:Homo sapiens


Alignment Length:273 Identity:73/273 - (26%)
Similarity:101/273 - (36%) Gaps:81/273 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PGIKRSDSLDPIANTTILSVPQRPSSPR-QFFERLYGHLETRSSENGEIDVGTHAHKPPP---CD 75
            |...|...|.|..:    ..|....:|: ..|...:..:.::||      |..|.:.|.|   .|
Human    35 PAAARPSGLVPDCS----DFPSCSFAPKPAVFSTSWAPVPSQSS------VVYHPYGPQPHLGAD 89

  Fly    76 TPYHSD-----GGSVSSPDISISDERTSLA--AYP---AYDFYGHAKDYPQHPSQQHQQHHHHHH 130
            |.|...     .|:||.|.........:|.  |||   |....|..:.||.:             
Human    90 TRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPDY------------- 141

  Fly   131 HPPQLVHQKLSYVSPPPAIAAGGAANPVLPHAFPAGFPSDPHFSAGFSAFLARRRRKEGR----- 190
                      .|.||       |......|...|:     |...|     ||..:.||.:     
Human   142 ----------MYGSP-------GELRDRAPQTLPS-----PEADA-----LAGSKHKEEKADLDP 179

  Fly   191 ------------QRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRR 243
                        .|::|..::..|||.||.||..|.|::|.||:|:|..|.|||.|:||||||||
Human   180 SNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRR 244

  Fly   244 AKDKRIEKAQIDQ 256
            .|.|::.|.:.|:
Human   245 MKMKKMNKEKTDK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
HOXC9NP_008828.1 Hox9_act 1..179 CDD:368024 40/193 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..181 19/100 (19%)
HOX 192..241 CDD:197696 24/48 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.