DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and HOXC8

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_073149.1 Gene:HOXC8 / 3224 HGNCID:5129 Length:242 Species:Homo sapiens


Alignment Length:251 Identity:62/251 - (24%)
Similarity:90/251 - (35%) Gaps:78/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KRSDSLDP----------IANTTILSVPQRPSSPRQFFERLYGHLETRSSENGEIDVGTHAHKPP 72
            |..:||:|          :..:..|......|:|.  |:....|::. ...:|...:....::..
Human    14 KAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPG--FQHASHHVQD-FFHHGTSGISNSGYQQN 75

  Fly    73 PCDTPYHSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKD-----YPQ-----HPSQQHQQHHH 127
            ||....|.|.......:           |.|....||..::     ||.     :.:....|.|.
Human    76 PCSLSCHGDASKFYGYE-----------ALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHL 129

  Fly   128 HHHHPPQLVHQKLSYVSPPPAIAAGGAANPVLPHAFPAGFPSDPHFSAGFSAFLARRRRKEGRQR 192
            :.:..|.|:                          ||...|..|             .|:.||| 
Human   130 NQNSSPSLM--------------------------FPWMRPHAP-------------GRRSGRQ- 154

  Fly   193 RQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKR 248
                |:|..|||.||.||..|.|::|.||.|::..|.|||.|:||||||||.|.|:
Human   155 ----TYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
HOXC8NP_073149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..154 10/78 (13%)
Antp-type hexapeptide 138..143 2/30 (7%)
Homeobox 153..205 CDD:306543 31/56 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..242 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.