DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and HOXC5

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens


Alignment Length:241 Identity:68/241 - (28%)
Similarity:99/241 - (41%) Gaps:45/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IANTTILSVPQRPSSPRQFFERLYGHLETRSSE--NGEIDVGTHAHKPPPCDTPYHSDGGSVSSP 88
            :||:.....|..|:...|.........|.::|.  .|.:|:......|.|.::.:..|  ..::|
Human     5 VANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVD--MAANP 67

  Fly    89 DISISDERTSLAAYPAYDFYGHA----KDYPQHPSQQHQQHHHHHHHPPQL---------VHQKL 140
            .........|.||.|     |||    :..|.:|....|:...     |.|         :.::.
Human    68 RAHPDRPACSAAAAP-----GHAPGRDEAAPLNPGMYSQKAAR-----PALEERAKSSGEIKEEQ 122

  Fly   141 SYVSPPPAIAAGGAANPVLPHAFPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLR 205
            :....|    ||.:..|..|..:|  :.:..|.|            .|...:|.||:::..|||.
Human   123 AQTGQP----AGLSQPPAPPQIYP--WMTKLHMS------------HETDGKRSRTSYTRYQTLE 169

  Fly   206 LEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEK 251
            ||.|||.|.|::|.||.|:|..|.|.|.||||||||||.|.|:..|
Human   170 LEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 30/50 (60%)
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 17/86 (20%)
Antp-type hexapeptide 140..145 1/6 (17%)
Homeobox 158..211 CDD:306543 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.