DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and HOXB9

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_076922.1 Gene:HOXB9 / 3219 HGNCID:5120 Length:250 Species:Homo sapiens


Alignment Length:259 Identity:68/259 - (26%)
Similarity:94/259 - (36%) Gaps:107/259 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 ISISDERTSLAAYPAYDFYGH-AKDYP-------QHPSQQHQQHHHHHHHP-------------- 132
            :|||.   :|::|.......| ::|.|       |:.|.:...|..|...|              
Human     1 MSISG---TLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGAS 62

  Fly   133 ------------PQLVHQKLSYVSP---PPA---------------IAAGG------AANPVLPH 161
                        |.:.|   .|:.|   |||               .||.|      .|.|:|  
Human    63 WAPLSPHASGSLPSVYH---PYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLL-- 122

  Fly   162 AFPAGFPSD------PHF----SAGFSAFLARRRRKEG--------------------------- 189
                |.|.:      |.:    |||..|.|:.:|...|                           
Human   123 ----GAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHAR 183

  Fly   190 RQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQ 253
            ..|::|..::..|||.||.||..|.|::|.||.|:|..|.|:|.|:||||||||.|.|::.|.|
Human   184 SSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 27/50 (54%)
HOXB9NP_076922.1 Hox9_act 1..172 CDD:282473 36/182 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..47 6/25 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..182 2/32 (6%)
Homeobox 188..241 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.