Sequence 1: | NP_524521.1 | Gene: | ro / 43234 | FlyBaseID: | FBgn0003267 | Length: | 350 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_076922.1 | Gene: | HOXB9 / 3219 | HGNCID: | 5120 | Length: | 250 | Species: | Homo sapiens |
Alignment Length: | 259 | Identity: | 68/259 - (26%) |
---|---|---|---|
Similarity: | 94/259 - (36%) | Gaps: | 107/259 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 ISISDERTSLAAYPAYDFYGH-AKDYP-------QHPSQQHQQHHHHHHHP-------------- 132
Fly 133 ------------PQLVHQKLSYVSP---PPA---------------IAAGG------AANPVLPH 161
Fly 162 AFPAGFPSD------PHF----SAGFSAFLARRRRKEG--------------------------- 189
Fly 190 RQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQ 253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ro | NP_524521.1 | Homeobox | 196..247 | CDD:278475 | 27/50 (54%) |
HOXB9 | NP_076922.1 | Hox9_act | 1..172 | CDD:282473 | 36/182 (20%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 21..47 | 6/25 (24%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 149..182 | 2/32 (6%) | |||
Homeobox | 188..241 | CDD:278475 | 28/52 (54%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |